PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054888.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 165aa    MW: 18973.2 Da    PI: 10.1364
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054888.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.3e-261059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  +i+++  rqvtfskRrng+lKKA+ELS+LCdaev v+ifs t kl+e++s
  EcC054888.30 10 KIDSSASRQVTFSKRRNGLLKKAKELSILCDAEVGVVIFSCTSKLHEFAS 59
                  799*********************************************86 PP

2K-box584e-2079142770
         K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                   +++  ++ + lq+e+a Lk++++  q + Rhl+Ge+L++Ls+++Lq Le+qL  slk +R +K 
  EcC054888.30  79 EKNPFKELQLLQREVADLKQKLHDVQDNRRHLMGEGLSPLSVENLQILEKQLAMSLKAVRMRKV 142
                   4456678899****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.31161IPR002100Transcription factor, MADS-box
SMARTSM004327.0E-35160IPR002100Transcription factor, MADS-box
CDDcd002657.35E-42277No hitNo description
SuperFamilySSF554556.28E-30276IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-253859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-1685142IPR002487Transcription factor, K-box
PROSITE profilePS512979.55286165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043531Molecular FunctionADP binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGRGKIVIQK IDSSASRQVT FSKRRNGLLK KAKELSILCD AEVGVVIFSC TSKLHEFASS  60
SMRSTIDRYT KSKEDHHGEK NPFKELQLLQ REVADLKQKL HDVQDNRRHL MGEGLSPLSV  120
ENLQILEKQL AMSLKAVRMR KVCFHMLKFH HELAFCMFPY VEISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19181181Myocyte-specific enhancer factor 2B
1tqe_Q2e-19181181Myocyte-specific enhancer factor 2B
1tqe_R2e-19181181Myocyte-specific enhancer factor 2B
1tqe_S2e-19181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029976.14e-90PREDICTED: MADS-box transcription factor 23-like isoform X1
SwissprotQ6EP496e-60MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A059ATF84e-68A0A059ATF8_EUCGR; Uncharacterized protein
STRINGGSMUA_Achr3P20280_0012e-58(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-60AGAMOUS-like 16